Host: Rabbit
Target Protein: GRPP
IR: Immunogen Range:21-50/180
Clonality: Polyclonal
Isotype: IgG
Entrez Gene: 2641
Swiss Prot: P01275
Source: KLH conjugated synthetic peptide derived from human GRPP(C-RSLQDTEEKSRSFSASQADPLSDPDQMNED):21-50/180
Purification: affinity purified by Protein A
Storage: 0.01M TBS(pH7.4) with 1% BSA, 0.03% Proclin300 and 50% Glycerol. Shipped at 4℃. Store at -20 °C for one year. Avoid repeated freeze/thaw cycles.
Background: The protein encoded by this gene is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon. [provided by RefSeq].
Size: 200ul
Concentration: 1mg/ml
Applications: ELISA=1:5000-10000
Cross Reactive Species: (predicted: Human)
For research use only. Not intended for diagnostic or therapeutic use.