www.bioss.com.cn
400-901-9800
sales@bioss.com.cn
techsupport@bioss.com.cn
Rabbit
Anti-GRPP/AF488
Cat. Number:
bs-10995R-AF488
Concentration:
1mg/ml Buffer = 0.01M TBS(pH7.4) with 1% BSA, 0.03% Proclin300 and 50% Glycerol.
Background:
The protein encoded by this gene is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon. [provided by RefSeq].
Also known as:
glicentin-related polypeptide; GCG; Glicentin related polypeptide; Glucagon precursor; GRPP; Oxyntomodulin; OXM; OXY; GLUC_HUMAN.
Specificity:
●
Rabbit Polyclonal IgG, affinity purified by Protein A.
●
Reacts with:
(predicted: )
●
Immunogen: KLH conjugated synthetic peptide derived from human GLP 2(C-RSLQDTEEKSRSFSASQADPLSDPDQMNED).
●
Predicted Molecular Weight: 3.3kDa.
Storage:
0.01M TBS(pH7.4) with 1% BSA, 0.03% Proclin300 and 50% Glycerol Store at -20 °C for one year. Avoid repeated freeze/thaw cycles. The lyophilized antibody is stable at room temperature for at least one month and for greater than a year when kept at -20°C. When reconstituted in sterile pH 7.4 0.01M PBS or diluent of antibody the antibody is stable for at least two weeks at 2-4 °C.
Application:
Excitation spectrum: 495nm
Emission spectrum: 519nm
Not yet tested in other applications.
Optimal working dilutions must be determined by the end user.
Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications.